top of page

Research material

LL-37

LL-37 product image

LL-37 is a synthetic 37-amino-acid peptide corresponding to the mature human cathelicidin peptide produced from the C-terminal region of the hCAP-18 precursor protein. Its amino-acid sequence is [LL-37, 37 aa] LL-37 is a cationic,…

5mg

$69.00

Laboratory research use only. Not for human, veterinary, or clinical use.

bottom of page